Poudres stéroïdes de fabrication professionnelle, liquide stéroïde d'injection, peptides, HGH176-191, Sarms, matières premières pharmaceutiques (Phenacetin), GBL, anesthésiques locaux, BB, BA etc.

Maison Produitspeptides d'hormone de croissance

CAS 863288-34-0 peptides de la musculation CJC-1295 pour la production de GH d'augmentation

Certificat
De bonne qualité stéroïdes anabolisant androgènes en ventes
De bonne qualité stéroïdes anabolisant androgènes en ventes
C'est une expérience unforgetable. J'étais surprise au sujet de paquet discret et livraison rapide quand je passe commande dans la première fois !

—— Aitor Parazation-Pays-Bas

La coutume de passage de sécurité, le paquet gentil et la qualité superbe sont mon meilleur favorables. Oui, ils peuvent le faire et ils ont fait cela. Je suis si heureux…

—— Michael Decapvcca-R-U

COM Éric, clientes de negócios du fazer I de seus de por de responsável de sempre d'é d'ele. Apuros de fin de support de cheguei de Quando, iria d'ele j'ajudar une resolvê-visibilité directe. melhor sentir-Se

—— PRISCILLA De OLIVEIRA-Brésil

Je suis en ligne une discussion en ligne

CAS 863288-34-0 peptides de la musculation CJC-1295 pour la production de GH d'augmentation

Chine CAS 863288-34-0 peptides de la musculation CJC-1295 pour la production de GH d'augmentation fournisseur

Image Grand :  CAS 863288-34-0 peptides de la musculation CJC-1295 pour la production de GH d'augmentation

Détails sur le produit:

Lieu d'origine: Fabriqué en Chine
Nom de marque: NJBN STEROID
Certification: ISO9001 , SGS , KOSHER
Numéro de modèle: 863288-34-0

Conditions de paiement et expédition:

Quantité de commande min: 10g
Prix: Negotiation
Détails d'emballage: 2mg/vial, 10vials/kit, 1g/bag
Délai de livraison: 4~6 jours ouvrables après paiement par le messager exprès
Conditions de paiement: Union occidentale, Moneygram, T/T et Bitcoin
Capacité d'approvisionnement: 1500kg/Month
Description de produit détaillée
Utilisation: Augmentez la production de GH CAS: 863288-34-0
marché: Global Apparence: poudre blanche
Quantité d'ordre minimum: 10g Exemple: libre

Peptides chauds CAS de musculation de vente 863288-34-0 CJC-1295 pour la production de GH d'augmentation

 

Détail rapide :

 

Nom de produit CJC1295
Synonymes CJC1295 ; Y (d - A) DAIFTQSYRKVLAQLSARKLLQDILSR-NH2 ; L-Tyrosyl-D-alanyl-L-alpha-aspartyl-L-alanyl-L-isoleucyl-L-phenylalanyl-L-threonyl-L-glutaminyl-L-seryl-L-tyrosyl-L-arginyl-L-lysyl-L-valyl-L-leucyl-L-alanyl-L-glutaminyl-L-seryl-L-alanyl-L-arginyl-L-lysyl-L-leucyl-L-leucyl-L-glutaminyl-L-alpha-aspartyl-L-isoleucyl-L-leucyl-L-seryl-L-arginyl-N6- [3 (2,5-dihydro-2,5-dioxo-1H-pyrrol-1-yl) - 1-oxopropyl] - L-lysinamide ; Acétate CJC-1295 ; CJC1295 avec DAC
Nombre de registre de CAS 863288-34-0
Formule moléculaire C159H258N46O45
Catégories de produit Peptides
Analyse 99%
Aspect poudre blanche
Utilisation Augmentez la production de GH
Quantité d'ordre minimum 10g
Expédition Par le messager exprès
Délai d'exécution de expédition D'ici 24 heures après réception du paiement
Options de paiement Western Union, MoneyGram, T/T, Bitcoin
Prix Négocié

 

Description :

 

1.by Bill RobertsCJC-1295 est un peptide injectable employé pour augmenter la production de GH. Ce peptide est une hormone de croissance libérant l'hormone (GHRH) mimetic, ou analogue. C'est-à-dire, cela fonctionne comme GHRH, et peut être mentionné comme être une utilisation principale de GHRH.The de CJC-1295 est de fournir les niveaux accrus de GH, qui a également comme conséquence IGF-1levels accru. Une augmentation de ces niveaux peut faciliter la grosse perte et parfois peut faciliter le gain de muscle aussi bien. Généralement, un produit dans la catégorie de GHRH, y compris CJC-1295, est choisi comme remplaçant à employer le GH, et seulement rarement est combiné avec le GH.

 

l'autre GHRH produit principal de 2.The est mod GRF 1-29, quedansla plupart desexemplesjerecommandeau-dessusdeCJC-1295. Lesproduitsdiffèrentdansleurduréed'action. ModGRFauneduréeapproximatif-idéaled'actionpermettantledosagepulsatile, tandis queCJC-1295auneduréeprolongéede l'actionquiempêcheun teldosage. Ilestimportantd'éviterde confondreCJC-1295avec« CJC-1295 sans DAC. » Ce dernier n'est pas CJC-1295, mais est plutôt mod mal nommé GRF. Quand un peptide n'a pas DAC, ce n'est pas CJC-1295.CJC 1295 est parfois lancé sur le marché en tant que « CJC-1295 avec DAC. » C'est simplement CJC-1295.

 

Quand employer CJC-1295

 

le produit 1.This est plus adapté aux exemples où une personne souhaite injecter rarement et cherche le soutien substantiel de la production de GH plutôt qu'un maximum ou une augmentation de proche-maximum. C'est parce que les taux sanguins plats qu'il fournit ne s'assortissent pas bien avec le dosage pulsatile, qui est nécessaire pour le plus grand effet. Les niveaux réguliers peuvent fournir l'appui très bon pour des impulsions naturelles de GH, cependant.

 

2.Relatively rarement, effets secondaires défavorables liés à l'utilisation excessive de GH, telle que la douleur de la compression de nerf (telle que la douleur de tunnel de carpal), conservation excessive de l'eau, ou sensibilité réduite d'insuline peuvent se produire de l'utilisation CJC-1295. La cause est stimulation d'une plus grande quantité de production de GH que convient au cas particulier. La solution est de discontinuer l'utilisation jusqu'à ce que le problème soit resolved, et de réduire le dosage en reprenant l'appui actuel d'use.for de la production de GH, aux doses recommandées ci-dessous, CJC-1295 n'a pas besoin d'être faite un cycle.

 

Comment employer CJC-1295

 

1.CJC 1295 est typiquement fourni dans des fioles contenant mg 2 ou 5 de poudre lyophylized, bien que la quantité puisse varier. Le contenu devrait être reconstitué en ajoutant une quantité commode de l'eau stérile ou bactériostatique. Si par exemple 2 ml sont choisis et le dosage de la fiole est mg 2, la solution en résultant alors a une concentration de 1 mg/ml, ou 1000 mcg/mL.


la période 2.At du dosage, une seringue d'insuline est utilisée pour retirer et puis injecter le montant désiré. Dans l'exemple ci-dessus, une dose 1000 de magnétocardiogramme exigerait un volume de 1 ml, ou « 100 unités internationales » comme marquées sur une seringue d'insuline.

L'injection peut être sous-cutanée, intramusculaire, ou intravenous selon la préférence personnelle. Si désirées, des solutions de peptide d'autres fioles, telles qu'une fiole d'un produit de GHRP, peuvent également être dessinées dans la même seringue, s'il y a pièce. Ceci réduit tout le nombre d'injections required.when recommandant CJC 1295, je recommande d'habitude un dosage du magnétocardiogramme 1000 à la fois, deux fois par semaine.

 

Application : 

 

1.CJC-1295 agit beaucoup plus longtemps que GRF pur. Il agit sur la glande pituitaire et maintient stimuler la libération de l'hormone de croissance dans les impulsions. La raison pour laquelle elle agit dans les impulsions est parce que l'axe de l'hormone de croissance humaine commande quelle quantité d'hormone peut rester dans le corps à la fois. Ceci maintient l'environnement homéostatique dans le corps.

 

la technologie de 2.The DAC dans le CJC-1295 permet au composé de se lier en covalence avec de la n'importe quelle albumine de circulation, après qu'elle ait été administrée par une injection sous-cutanée. Cependant, la raison pour laquelle la demi vie pourrait être prolongée de quelques minutes à plusieurs jours est plus profonde. Le groupe réactif dans le CJC-1295 lie à un peptide par le bioconjugation. Le peptide alors trouve une unité neucleophilic dans le sang et réagit avec lui afin de créer un lien plus ferme.

 

3.When utilisant n'importe quel GHRH, il devrait toujours se rappeler que des résultats positifs ne peuvent pas être réalisés du jour au lendemain. Ces composés agissent solidement au fil du temps, et les meilleurs résultats peuvent être réalisés lentement, et avec un régime nutritif et un régime approprié d'exercice. En outre, ces peptides ne sont pas selon le sexe, ainsi ils n'ont aucun effet androgène. Ils peuvent être employés par des femmes dans les mêmes dosages que les hommes font.

 

Pourquoi vous nous choisissez :

 

  • De haute qualité avec le prix concurrentiel

Nous sommes fabricant et pouvons fournir aux produits de haute qualité le prix concurrentiel, offrant des aperçus gratuits totest, quelques uns des honoraires d'expédition seulement.

 

  • Terme flexible de paiement

Nous acceptons chaque terme de paiement, tel que T/T, Bitcoin, Moneygram, Western Union.

 

  • La livraison rapide et sûre

 

1)Le colis peut être envoyé en 24 heures après comfirming le paiement.
2) Diverses méthodes de transport pour votre choix, tel que le SME, Fedex, TNT, DHL, USP.
3) Nous avons notre propre agent qui peut nous aider à embarquer nos produits fastly et sans risque, et nous prenons assez d'actions dedans là pour le transfert.
4)Nous avons la manière spéciale pourrions embarquer 10g aux produits sveral de kilogramme un moment. Nous offrons la poudre de fonte dans le service liquide. Et embarquez le liquide des manières spéciales de paquet.
5)Offrez le dernier numéro de suivi pour vous au contrôle.

 

  • Nous avons des clients dans le monde entier

 

1)Le service professionnel et l'expérience riche incitent des clients à se sentir confortables et à nous faire confiance.
2)À actions appropriées (telles que d'anti stéroïdes d'oestrogène) et rassemblement rapide de la livraison leur demande.
3)Le retour du marché et le retour de produits seront appréciés, répondant à l'exigence de clients est notre responsabilité.
4) Gain de haute qualité et de prix concurrentiel la confiance et l'éloge des clients autour du monde.

 

  • Bon service après-vente

 

1)Dites la mise à jour de paquet DÈS QUE POSSIBLE, et essayerez le meilleur résolvent quand le client a rencontré de divers problèmes.
2)Nous vous enseignerons que les recettes et les instructions pour tout le genre de stéroïde de transformer la poudre en liquide, et le liquide deviennent les stériles.

 

L'information entrante en contact :

Skype : teresa556678

Personne de contact : Teresa

Email : teresa@chembj.com

Whatsapp : +8617327095740

Site Web : www.realanabolicsteroids.com

 

CAS 863288-34-0 peptides de la musculation CJC-1295 pour la production de GH d'augmentation

 

Coordonnées
Nanjing Bangnuo Biotechnology Co., Ltd

Personne à contacter: CPSS

Téléphone: +8617327093119

Envoyez votre demande directement à nous (0 / 3000)